PARIS (ZNF746) Rabbit Polyclonal Antibody

SKU TA345411

Rabbit Polyclonal Anti-ZNF746 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF746 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF746. Synthetic peptide located within the following region: PWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 70 kDa
• Gene Name: zinc finger protein 746
• Database Link:
  NP_001156946
  Q6NUN9
• Background: ZNF746 may be involved in transcriptional regulation.
• Synonyms: PARIS
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data