TRAPPC14 Rabbit Polyclonal Antibody

CAT#: TA344887

Rabbit Polyclonal Anti-C7orf43 Antibody - middle region

Product Images

WB Suggested Anti-C7orf43 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate

• 

  Host: Rabbit; Target Name: C7orf43; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: C7orf43; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml; C7orf43 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C7orf43 antibody: synthetic peptide directed towards the middle region of human C7orf43. Synthetic peptide located within the following region: DLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: chromosome 7 open reading frame 43
• Database Link:
  NP_060745
  Entrez Gene 55262 Human
  UniProt ID Q8WVR3
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp761G0712; FLJ10925
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%