JNK3 (MAPK10) Rabbit Polyclonal Antibody

CAT#: TA344632

Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region

Product Images

WB Suggested Anti-Mapk10 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Liver

• 

  Lanes: Lane 1: 40 ug tobacco hornworm larvae intestine lysate; Lane 2: 100 ug tobacco hornworm larvae intestine lysate; Primary Antibody Dilution: 1:1000; Secondary Antibody: Goat anti-rabbit HRP; Secondary Antibody Dilution: 1:10000; Gene Name: Mapk10 (JUNK

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat, Tobacco hornworm
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: mitogen-activated protein kinase 10
• Database Link:
  NP_002744
  Entrez Gene 25272 Rat
  UniProt ID P53779
• Background: Mapk10 is a stress-activated protein kinase.
• Synonyms: JNK3; JNK3A; p54bSAPK; p493F12; PRKM10; SAPK1b
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Adipocytokine signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Fc epsilon RI signaling pathway, Focal adhesion, GnRH signaling pathway, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway, Type II diabetes mellitus, Wnt signaling pathway