TXNL2 (GLRX3) Rabbit Polyclonal Antibody

SKU TA344258

Rabbit Polyclonal Anti-GLRX3 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GLRX3 antibody: synthetic peptide directed towards the N terminal of human GLRX3. Synthetic peptide located within the following region: MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: glutaredoxin 3
• Database Link:
  NP_006532
  O76003
• Background: GLRX3 may play a role in regulating the function of the thioredoxin system.
• Synonyms: GLRX4; GRX3; GRX4; PICOT; TXNL2; TXNL3
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 86%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome