Gasdermin like (GSDMB) Rabbit Polyclonal Antibody

SKU
TA344156
Rabbit Polyclonal Anti-GSDML Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GSDML antibody: synthetic peptide directed towards the N terminal of human GSDML. Synthetic peptide located within the following region: HLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQIL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 45 kDa
Gene Name gasdermin B
Database Link
Background GSDML belongs to the gasdermin family.GSDML may play a role as secretory or metabolic product involved in secretory pathway. It may also play a role in achieving and maintaining the final differentiation state of epithelial cells.
Synonyms GSDML; PP4052; PRO2521
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%
Reference Data
Write Your Own Review
You're reviewing:Gasdermin like (GSDMB) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.