Nectin 3 (NECTIN3) Rabbit Polyclonal Antibody

CAT#: TA344115

Reviews ()
Write a review

Rabbit Polyclonal Anti-PVRL3 Antibody

Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the middle region of human PVRL3. Synthetic peptide located within the following region: PDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 61 kDa
Gene Name nectin cell adhesion molecule 3
Background Nectins (e.g., PVRL1; MIM 600644) are immunoglobulin-like adhesion molecules that interact with afadin (AF6; MIM 159559). Afadin is an actin filament-binding protein that connects nectins to the actin cytoskeleton. The nectin-afadin system organizes adherens junctions cooperatively with the cadherin (see MIM 192090)-catenin (see MIM 116805) system in epithelial cells.
Synonyms CD113; CDW113; NECTIN-3; PPR3; PRR3; PVRL3; PVRR3
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Adherens junction, Cell adhesion molecules (CAMs)
Other products for "NECTIN3"
Frequently bought together (2)
Transient overexpression lysate of poliovirus receptor-related 3 (PVRL3)
    • 100 ug

USD 495.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
Clone ID reveals the Source of Monoclonal Antibodies