neurobeachin like 1 (NBEAL1) Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "neurobeachin like 1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NBEAL1 antibody: synthetic peptide directed towards the N terminal of human NBEAL1. Synthetic peptide located within the following region: KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 153 kDa |
Gene Name | neurobeachin like 1 |
Database Link | |
Background | NBEAL1 belongs to the WD repeat neurobeachin family. It contains 1 BEACH domain and 2 WD repeats. NBEAL1 is highly expressed in brain, kidney, prostate and testis and weakly expressed in ovary, small intestine, colon and peripheral blood leukocytes. It may be correlative to several tumors, such as ovary serous adenocarcinoma and metastasis mammary gland carcinoma breast. |
Synonyms | A530083I02Rik; ALS2CR16; ALS2CR17; FLJ22838; FLJ26555; MGC164581; MGC168834 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 79%; Pig: 77%; Guinea pig: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.