Mbnl2 Rabbit Polyclonal Antibody

CAT#: TA343902

Rabbit Polyclonal Anti-Mbnl2 Antibody

Product Images

Host: Rabbit; Target Name: Mbnl2; Sample Tissue: Rat Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Mbnl2 antibody is: synthetic peptide directed towards the middle region of RAT Mbnl2. Synthetic peptide located within the following region: IACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: muscleblind-like splicing regulator 2
• Database Link:
  NP_001104534
  Entrez Gene 680445 Rat
  UniProt ID F2Z3T4
• Background: Mbnl2 mediates pre-mRNA alternative splicing regulation. It acts either as activator or repressor of splicing on specific pre-mRNA targets. It inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. It antagonizes the alternative splicing activity pattern of CELF proteins. RNA-binding protein that binds to 5'ACACCC-3' core sequence, termed zipcode, within the 3' UTR of ITGA3. It binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. It seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm at adhesion plaques. It may play a role in myotonic dystrophy pathophysiology (DM).
• Synonyms: DKFZp781H1296; MBLL; MBLL39; MGC120625; MGC120626; MGC120628; MLP1; OTTHUMP00000178763; PRO2032
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%