RBM7 Rabbit Polyclonal Antibody

CAT#: TA343840

Rabbit Polyclonal Anti-RBM7 Antibody

Product Images

WB Suggested Anti-RBM7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Liver

• 

  Rabbit Anti-RBM7 antibody; Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBM7 antibody: synthetic peptide directed towards the middle region of human RBM7. Synthetic peptide located within the following region: SFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: RNA binding motif protein 7
• Database Link:
  NP_057174
  Entrez Gene 10179 Human
  UniProt ID Q9Y580
• Background: RBM7 contains 1 RRM (RNA recognition motif) domain. It is possible involved in germ cell RNA processing and meiosis.
• Synonyms: FLJ11153
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 92%; Guinea pig: 86%; Rabbit: 85%; Bovine: 79%