TOX4 Rabbit Polyclonal Antibody

CAT#: TA343756

Rabbit Polyclonal Anti-TOX4 Antibody

Product Images

Host: Rabbit; Target Name: TOX4; Sample Tissue: Lung tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TOX4 antibody is: synthetic peptide directed towards the C-terminal region of Human TOX4. Synthetic peptide located within the following region: RCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: TOX high mobility group box family member 4
• Database Link:
  NP_055643
  Entrez Gene 9878 Human
  UniProt ID O94842
• Background: The function of this protein remains unknown.
• Synonyms: C14orf92; KIAA0737; LCP1; MIG7
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Goat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Zebrafish: 77%

Reference Data

• Protein Families: Transcription Factors