SOX15 Rabbit Polyclonal Antibody

CAT#: TA343646

Reviews ()
Write a review

Rabbit Polyclonal Anti-SOX15 Antibody


Product Datasheet for 'TA343646'


Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 310.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SOX15 antibody: synthetic peptide directed towards the middle region of human SOX15. Synthetic peptide located within the following region: ASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Predicted Protein Size 25 kDa
Gene Name SRY-box 15
Background SOX15 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.
Synonyms SOX20; SOX26; SOX27
Note Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Rat: 86%
Reference Data
Protein Families Transcription Factors
Other products for "SOX15"
Frequently bought together (2)
Transient overexpression lysate of SRY (sex determining region Y)-box 15 (SOX15)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies