SMN1 Rabbit Polyclonal Antibody

SKU
TA343298
Rabbit Polyclonal Anti-SMN1 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SMN1 antibody is: synthetic peptide directed towards the C-terminal region of SMN1. Synthetic peptide located within the following region: PPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 28 kDa
Gene Name survival of motor neuron 1, telomeric
Database Link
Background SMN1 localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein.
Synonyms BCD541; GEMIN1; SMA; SMA1; SMA2; SMA3; SMA4; SMA@; SMN; SMNT; T-BCD541; TDRD16A
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Guinea pig: 92%; Mouse: 85%; Rabbit: 85%; Bovine
Reference Data
Protein Categories Intracellular Proteins, Nervous system: Neurodegenerative diseases
Protein Families Druggable Genome, Stem cell - Pluripotency
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.