IRAK1BP1 Rabbit Polyclonal Antibody

SKU TA343231

Rabbit Polyclonal Anti-IRAK1BP1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Irak1bp1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Irak1bp1. Synthetic peptide located within the following region: WEGQTDDHQLSRLPGTLTVQQKIKSATIHAASKVFITFEVKGKEKKKKHL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: interleukin 1 receptor associated kinase 1 binding protein 1
• Database Link:
  NP_001010844
  Q5VVH5
• Background: Irak1bp1 is a component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. It acts by enhancing RELA transcriptional activity.
• Synonyms: AIP70; SIMPL
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 92%; Pig: 83%; Dog: 79%

Reference Data

• Protein Families: Druggable Genome