COL21A1 Rabbit Polyclonal Antibody

CAT#: TA343211

Rabbit Polyclonal Anti-COL21A1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of collagen, type XXI, alpha 1 (COL21A1)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human collagen, type XXI, alpha 1 (COL21A1), 20 µg
    • 20 ug

USD 867.00

Other products for "COL21A1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-COL21A1 antibody is: synthetic peptide directed towards the C-terminal region of Human COL21A1. Synthetic peptide located within the following region: PGEPGYMGLPGIQGKKGDKGNQGEKGIQGQKGENGRQGIPGQQGIQGHHG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Gene Name collagen type XXI alpha 1 chain
Background This gene encodes the alpha chain of type XXI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Type XXI collagen is localized to tissues containing type I collagen so, like other members of this collagen family, it may serve to maintain the integrity of the extracellular matrix. An alternatively spliced transcript variant has been described, but its full-length nature has yet to be determined.
Synonyms COLA1L; dJ682J15.1; dJ708F5.1; FP633
Note Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.