TOM1L1 Rabbit Polyclonal Antibody

SKU
TA343175
Rabbit Polyclonal Anti-TOM1L1 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Tom1l1 antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Tom1l1. Synthetic peptide located within the following region: INTTQDGPKDAVKALKKRISKNYNHKEIQLSLSLIDMCVQNCGPSFQSLI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 43 kDa
Gene Name target of myb1 like 1 membrane trafficking protein
Database Link
Background Tom1l1 is a probable adapter protein involved in signaling pathways. It interacts with the SH2 and SH3 domains of various signaling proteins when it is phosphorylated. This protein may promote FYN activation, possibly by disrupting intramolecular SH3-dependent interactions.
Synonyms KNS-CL.3; OK; SRCASM
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Categories Intracellular Proteins
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.