D aspartate oxidase (DDO) Rabbit Polyclonal Antibody

CAT#: TA343143

Reviews ()
Write a review

Rabbit Polyclonal Anti-DDO Antibody

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DDO antibody: synthetic peptide directed towards the N terminal of human DDO. Synthetic peptide located within the following region: TQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 41 kDa
Gene Name D-aspartate oxidase
Background The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction. Two transcript variants encoding different isoforms have been found for this gene.
Synonyms DASOX; DDO-1; DDO-2
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Pathways Alanine, aspartate and glutamate metabolism
Frequently bought together (3)
Recombinant protein of human D-aspartate oxidase (DDO), transcript variant 1
    • 20 ug

USD 748.00

Transient overexpression lysate of D-aspartate oxidase (DDO), transcript variant 1
    • 100 ug

USD 360.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
Clone ID reveals the Source of Monoclonal Antibodies