OriGene Logo

MAP3K12 binding inhibitory protein 1 (MBIP) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342913
Rabbit Polyclonal Anti-MBIP Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY413886 Transient overexpression lysate of MAP3K12 binding inhibitory protein 1 (MBIP), transcript variant 1 100 ug
$436.00
TP302668 Recombinant protein of human MAP3K12 binding inhibitory protein 1 (MBIP), transcript variant 1, 20 µg
20 ug
$737.00

View other "MAP3K12 binding inhibitory protein 1 or NM_016586" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MBIP antibody is: synthetic peptide directed towards the N-terminal region of Human MBIP. Synthetic peptide located within the following region: EVNDKFSIGDLQEEEKHKESDLRDVKKTQIHFDPEVVQIKAGKAEIDRRI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 39 kDa
Gene Name MAP3K12 binding inhibitory protein 1
Database Link
Background MBIP inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
Synonyms MAP3K12 binding inhibitory protein 1; MUK-binding inhibitory protein; OTTHUMP00000178844
Note Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Pig: 79%; Horse: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.