AKR1C1 Rabbit Polyclonal Antibody

SKU
TA342867
Rabbit Polyclonal Anti-AKR1C1 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human, Monkey
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-AKR1C1 antibody: synthetic peptide directed towards the N terminal of human AKR1C1. Synthetic peptide located within the following region: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 36 kDa
Gene Name aldo-keto reductase family 1, member C1
Database Link
Background This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
Synonyms 2-ALPHA-HSD; 20-ALPHA-HSD; C9; DD1; DD2; DDH; DDH1; H-37; HAKRC; HBAB; MBAB
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%; Horse: 86%; Sheep: 86%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Metabolism of xenobiotics by cytochrome P450
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.