OriGene Logo

MRGX3 (MRGPRX3) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342780
Rabbit Polyclonal Anti-MRGPRX3 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY403294 Transient overexpression lysate of MAS-related GPR, member X3 (MRGPRX3) 100 ug
$436.00

View other "MRGX3 or NM_054031" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MRGPRX3 antibody: synthetic peptide directed towards the C terminal of human MRGPRX3. Synthetic peptide located within the following region: FLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPEVDEGGGWL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 36 kDa
Gene Name MAS related GPR family member X3
Database Link
Background This gene encodes a member of the mas-related/sensory neuron specific subfamily of G protein coupled receptors. The encoded protein may be involved in sensory neuron regulation and in the modulation of pain.
Synonyms GPCR; MRGX3; SNSR1; SNSR2
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories GPCR, Membrane Proteins
Protein Families Druggable Genome, GPCR, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.