ZNF367 Rabbit Polyclonal Antibody

CAT#: TA342508

Reviews ()
Write a review

Rabbit Polyclonal Anti-ZNF367 Antibody



USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF367 antibody: synthetic peptide directed towards the C terminal of human ZNF367. Synthetic peptide located within the following region: GCLSRFTHANRHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWLARYWE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38 kDa
Gene Name zinc finger protein 367
Background ZNF367 is a transcriptional activator. Isoform 1 may be involved in transcriptional activation of erythroid genes.
Synonyms AFF29; CDC14B; ZFF29
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 93%
Reference Data
Protein Families Transcription Factors
Other products for "ZNF367"
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 367 (ZNF367)
    • 100 ug

USD 360.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies