SCAND3 (ZBED9) Rabbit Polyclonal Antibody

CAT#: TA342488

Rabbit Polyclonal Anti-SCAND3 Antibody

Product Images

WB Suggested Anti-SCAND3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SCAND3 antibody: synthetic peptide directed towards the C terminal of human SCAND3. Synthetic peptide located within the following region: ETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 152 kDa
• Gene Name: zinc finger BED-type containing 9
• Database Link:
  NP_443155
  Entrez Gene 114821 Human
  UniProt ID Q6R2W3
• Background: The function of SCAND3 has not yet been determined.
• Synonyms: Buster4; dJ1186N24.3; SCAND3; ZFP38-L; ZNF305P2; ZNF452
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%

Reference Data

• Protein Families: Transcription Factors