OriGene Logo

IRX6 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342475
Rabbit Polyclonal Anti-IRX6 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY411294 Transient overexpression lysate of iroquois homeobox 6 (IRX6) 100 ug
$665.00

View other "IRX6 or NM_024335" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-IRX6 antibody: synthetic peptide directed towards the N terminal of human IRX6. Synthetic peptide located within the following region: SFPHFGHPYRGASQFLASASSSTTCCESTQRSVSDVASGSTPAPALCCAP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 48 kDa
Gene Name iroquois homeobox 6
Database Link
Background IRX6 is one Iroquois (Irx) proteins comprise a family of homeodomain-containing transcription factors involved in patterning and regionalization of embryonic tissues in both vertebrates and invertebrates.
Synonyms IRX-3; IRX7; IRXB3
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 85%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.