MACO1 Rabbit Polyclonal Antibody

CAT#: TA342361

Rabbit Polyclonal Anti-TMEM57 Antibody

Product Images

WB Suggested Anti-TMEM57 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: MDA-MB-435S cell lysate

• 

  Host: Rabbit; Target Name: TMEM57; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: TMEM57; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: TMEM57; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM57 antibody: synthetic peptide directed towards the N terminal of human TMEM57. Synthetic peptide located within the following region: VVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVFFVCVAF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: transmembrane protein 57
• Database Link:
  NP_060672
  Entrez Gene 55219 Human
  UniProt ID Q8N5G2
• Background: The exact function of this protein remains unknown
• Synonyms: MACOILIN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane