OriGene Logo

Activator of basal transcription 1 (ABT1) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342311
Rabbit Polyclonal Anti-Abt1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY415635 Transient overexpression lysate of activator of basal transcription 1 (ABT1) 100 ug
$436.00
TP309762 Recombinant protein of human activator of basal transcription 1 (ABT1), 20 µg
20 ug
$867.00

View other "Activator of basal transcription 1 or NM_013375" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Abt1 antibody: synthetic peptide directed towards the middle region of mouse Abt1. Synthetic peptide located within the following region: RQRLRAEVAQAKRETDFYLRNVEQGQHFLAADGDATRPNSSWTFTQRPTE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 31 kDa
Gene Name activator of basal transcription 1
Database Link
Background Could be a novel TATA-binding protein (TBP) which can function as a basal transcription activator. Can act as a regulator of basal transcription for class II genes.
Synonyms hABT1
Note Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Pig: 92%; Guinea pig: 92%; Horse: 83%; Human: 83%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.