The immunogen for anti-MYO1E antibody: synthetic peptide directed towards the middle region of human MYO1E. Synthetic peptide located within the following region: PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR
Buffer
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
This gene encodes a member ofThe nonmuscle class I myosins which are a subgroup ofThe unconventional myosin protein family.The unconventional myosin proteins function as actin-based molecular motors. Class I myosins are characterized by a head (motor) domain, a regulatory domain and a either a short or long tail domain. AmongThe class I myosins,This protein is distinguished by a long tail domain that is involved in crosslinking actin filaments.This protein localizes toThe cytoplasm and may be involved in intracellular movement and membrane trafficking. Mutations inThis gene areThe cause of focal segmental glomerulosclerosis-6.This gene has been referred to as myosin IC inThe literature but is distinct fromThe myosin IC gene located on chromosome 17. provided by RefSeq, Jan 2012
Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Price:
Actual Price:
Redirect notification
You will be redirected to our european store (OriGene Technologies GmbH) based on your location
