ADA2 Rabbit Polyclonal Antibody

CAT#: TA342028

Rabbit Polyclonal Anti-CECR1 Antibody

Product Images

WB Suggested Anti-CECR1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CECR1 antibody: synthetic peptide directed towards the N terminal of human CECR1. Synthetic peptide located within the following region: MQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: cat eye syndrome chromosome region, candidate 1
• Database Link:
  NP_059120
  Entrez Gene 51816 Human
  UniProt ID Q9NZK5
• Background: This gene encodes a member of a subfamily ofThe adenosine deaminase protein family.The encoded protein is one of two adenosine deaminases found in humans, which regulate levels ofThe signaling molecule, adenosine.The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation.This gene may be responsible for some ofThe phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
• Synonyms: ADA2; ADGF; IDGFL
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane