OriGene Logo

FKBP11 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342020
Rabbit Polyclonal Anti-FKBP11 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY402578 Transient overexpression lysate of FK506 binding protein 11, 19 kDa (FKBP11), transcript variant 1 100 ug
$436.00
TP306481 Recombinant protein of human FK506 binding protein 11, 19 kDa (FKBP11), transcript variant 1, 20 µg
20 ug
$867.00

View other "FKBP11 or NM_016594" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FKBP11 antibody: synthetic peptide directed towards the N terminal of human FKBP11. Synthetic peptide located within the following region: VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 19 kDa
Gene Name FK506 binding protein 11
Database Link
Background FKBP11 belongs toThe FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyzeThe folding of proline-containing polypeptides.The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited byThe immunosuppressant compounds FK506 and rapamycin (Rulten et al., 2006 PubMed 16596453). supplied by OMIM, Mar 2008. Transcript Variant:This variant (1) encodesThe longest isoform (1). ##Evidence-Data-START## Transcript exon combination :: AY358998.1, BC027973.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS025087, ERS025093 ECO:0000348 ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms FKBP19
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Bovine: 93%; Goat: 83%; Zebrafish: 77%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.