OriGene Logo

TMEM66 (SARAF) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341997
Rabbit Polyclonal Anti-TMEM66 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY414173 Transient overexpression lysate of transmembrane protein 66 (TMEM66) 100 ug
$436.00

View other "TMEM66 or NM_016127" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TMEM66 antibody: synthetic peptide directed towards the middle region of human TMEM66. Synthetic peptide located within the following region: TNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 37 kDa
Gene Name store-operated calcium entry associated regulatory factor
Database Link
Background TMEM66 is a multi-pass membrane protein. It belongs toThe TMEM66 family.The exact function of TMEM66 remains unknown.
Synonyms FOAP-7; HSPC035; TMEM66; XTP3
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Pig: 90%; Bovine: 90%; Guinea pig: 86%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.