ABI3BP Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-ABI3BP antibody is: synthetic peptide directed towards the C-terminal region of Human ABI3BP. Synthetic peptide located within the following region: PVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYSECKGKQYVKR |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 53 kDa |
| Gene Name | ABI family member 3 binding protein |
| Database Link | |
| Background | ABI3BP contains 2 fibronectin type-III domains.The loss of ABI3BP expression could play a functional role in thyroid tumorigenesis. It also presumably represents a trigger gene for evoking cellular senescence, which has also been suggested to be involved inThe prevention of tumorigenesis. |
| Synonyms | NESHBP; TARSH |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Secreated Proteins |
| Protein Families | Druggable Genome, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.