OriGene Logo

Syndecan 3 (SDC3) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341948
Rabbit Polyclonal Anti-Sdc3 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "Syndecan 3 or NM_014654" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Sdc3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 46 kDa
Gene Name syndecan 3
Database Link
Background Cell surface proteoglycan that may bear heparan sulfate. May have a role inThe organization of cell shape by affectingThe actin cytoskeleton, possibly by transferring signals fromThe cell surface in a sugar-dependent mechanism.
Synonyms SDCN; SYND3
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Categories Endocrine and metabolic diseases, Membrane Proteins
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), ECM-receptor interaction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.