ERVWE1 (ERVW-1) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-ERVW-1 antibody is: synthetic peptide directed towards the N-terminal region of Human ERVW-1. Synthetic peptide located within the following region: CMTSSSPYQEFLWRMQRPGNIDAPSYRSLSKGTPTFTAHTHMPRNCYHSA |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 59 kDa |
| Gene Name | endogenous retrovirus group W member 1 |
| Database Link | |
| Background | Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction.This gene is part of an HERV provirus on chromosome 7 that has inactivating mutations inThe gag and pol genes.This gene isThe envelope glycoprotein gene which appears to have been selectively preserved.The gene's protein product is expressed inThe placental syncytiotrophoblast and is involved in fusion ofThe cytotrophoblast cells to formThe syncytial layer ofThe placenta.The protein hasThe characteristics of a typical retroviral envelope protein, including a furin cleavage site that separatesThe surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encodingThe same protein have been found forThis gene. provided by RefSeq, Mar 2010 |
| Synonyms | ENV; ENVW; ERVWE1; HERV-7q; HERV-W-ENV; HERV7Q; HERVW; HERVWENV |
| Note | Immunogen Sequence Homology: Human: 100%; Rat: 86% |
| Reference Data | |
| Protein Categories | Membrane Proteins |
| Protein Families | Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.