OriGene Logo

NKX2.3 (NKX2-3) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341800
Rabbit Polyclonal Anti-NKX2-3 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY408008 Transient overexpression lysate of NK2 transcription factor related, locus 3 (Drosophila) (NKX2-3) 100 ug
$436.00

View other "NKX2.3 or NM_145285" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NKX2-3 antibody: synthetic peptide directed towards the middle region of mouse NKX2-3. Synthetic peptide located within the following region: GTHAPPPPPRRVAVPVLVRDGKPCVTPSAQTYGSPYGVGAGAYSYNSFPA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 40 kDa
Gene Name NK2 homeobox 3
Database Link
Background NKX2C is a member ofThe NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions.
Synonyms CSX3; NK2.3; NKX2.3; NKX2C; NKX4-3
Note Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 85%; Pig: 85%; Bovine: 85%; Guinea pig: 85%; Human: 77%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.