OriGene Logo

GJE1 (GJC3) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341681
Rabbit Polyclonal Anti-GJC3 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY405699 Transient overexpression lysate of gap junction protein, gamma 3, 30.2kDa (GJC3) 100 ug
$436.00

View other "GJE1 or NM_181538" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GJC3 antibody: synthetic peptide directed towards the middle region of human GJC3. Synthetic peptide located within the following region: WHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 31 kDa
Gene Name gap junction protein gamma 3
Database Link
Background This gene encodes a gap junction protein.The encoded protein, also known as a connexin, plays a role in formation of gap junctions, which provide direct connections between neighboring cells. Mutations inThis gene have been reported to be associated with nonsyndromic hearing loss. provided by RefSeq, Feb 2010
Synonyms CX29; CX30.2; CX31.3; GJE1
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.