OriGene Logo

DHX30 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341628
Rabbit Polyclonal Anti-DHX30 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY414895 Transient overexpression lysate of DEAH (Asp-Glu-Ala-His) box polypeptide 30 (DHX30), transcript variant 2 100 ug
$436.00
TP306486 Recombinant protein of human DEAH (Asp-Glu-Ala-His) box polypeptide 30 (DHX30), transcript variant 2, 20 µg
20 ug
$867.00

View other "DHX30 or NM_138614" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DHX30 antibody: synthetic peptide directed towards the N terminal of human DHX30. Synthetic peptide located within the following region: AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 40 kDa
Gene Name DEAH-box helicase 30
Database Link
Background DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The family member encoded byThis gene is a mitochondrial nucleoid protein that associates with mitochondrial DNA. It has also been identified as a component of a transcriptional repressor complex that functions in retinal development, and it is required to optimizeThe function ofThe zinc-finger antiviral protein. Alternatively spliced transcript variants have been found forThis gene. provided by RefSeq, Feb 2013
Synonyms DDX30; DEAD; DEAH (Asp-Glu-Ala-His) box polypeptide 30; FLJ11214; H (Asp-Glu-Ala-Asp; His) box polypeptide 30; KIAA0890; Ret-CoR; retina co-repressor
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.