MTREX Rabbit Polyclonal Antibody

CAT#: TA341595

Rabbit Polyclonal Anti-SKIV2L2 Antibody

Product Images

WB Suggested Anti-SKIV2L2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysateSKIV2L2 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SKIV2L2 antibody: synthetic peptide directed towards the N terminal of human SKIV2L2. Synthetic peptide located within the following region: KGPPGSADKAGKRFDGKLQSESTNNGKNKRDVDFEGTDEPIFGKKPRIEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 118 kDa
• Gene Name: Ski2 like RNA helicase 2
• Database Link:
  NP_056175
  Entrez Gene 23517 Human
  UniProt ID P42285
• Background: SKIV2L2 may be involved in pre-mRNA splicing.
• Synonyms: Dob1; fSAP118; KIAA0052; Mtr4
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Horse: 86%; Bovine: 86%; Pig: 85%; Mouse: 85%; Guinea pig: 85%

Reference Data

• Protein Pathways: RNA degradation