AKAP10 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-AKAP10 antibody: synthetic peptide directed towards the middle region of human AKAP10. Synthetic peptide located within the following region: ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 71 kDa |
| Gene Name | A-kinase anchoring protein 10 |
| Database Link | |
| Background | This gene encodes a member ofThe A-kinase anchor protein family. A-kinase anchor proteins bind toThe regulatory subunits of protein kinase A (PKA) and confineThe holoenzyme to discrete locations withinThe cell.The encoded protein is localized to mitochondria and interacts with bothThe type I and type II regulatory subunits of PKA. Polymorphisms inThis gene may be associated with increased risk of arrhythmias and sudden cardiac death. provided by RefSeq, May 2012 |
| Synonyms | AKAP-10; D-AKAP-2; D-AKAP2; PRKA10 |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 90% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
| Protein Families | Druggable Genome |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.