ZNF485 Rabbit Polyclonal Antibody

CAT#: TA341463

Reviews ()
Write a review

Rabbit Polyclonal Anti-ZNF485 Antibody

 Product Datasheet for 'TA341463'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Clone Name Polyclonal
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF485 antibody: synthetic peptide directed towards the C terminal of human ZNF485. Synthetic peptide located within the following region: SSGLVEHQRLHTGEKPYKCNECGKAFPRSSALKQHKKIHNKERAMKCS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml
Predicted Protein Size 46 kDa
Gene Name zinc finger protein 485
Background May be involved in transcriptional regulation.
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 86%; Horse: 86%; Rabbit: 86%; Pig: 85%; Bovine: 85%
Reference Data
Protein Families Transcription Factors
Other products for "ZNF485"
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 485 (ZNF485)
    • 100 ug

USD 315.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones