OriGene Logo

TGIF2LX Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341451
Rabbit Polyclonal Anti-TGIF2LX Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY408392 Transient overexpression lysate of TGFB-induced factor homeobox 2-like, X-linked (TGIF2LX) 100 ug
$436.00

View other "TGIF2LX or NM_138960" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TGIF2LX antibody: synthetic peptide directed towards the middle region of human TGIF2LX. Synthetic peptide located within the following region: SGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 27 kDa
Gene Name TGFB induced factor homeobox 2 like, X-linked
Database Link
Background This gene encodes a member ofThe TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests thatThis gene may play a role in spermatogenesis. A homolog ofThis gene lies withinThe male specific region of chromosome Y, in a block of sequence that is thought to beThe result of a large X-to-Y transposition. provided by RefSeq, Jul 2008
Synonyms TGIFLX
Note Immunogen Sequence Homology: Human: 100%; Rat: 77%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.