FAM119A (METTL21A) Rabbit Polyclonal Antibody

CAT#: TA340404

Rabbit Polyclonal Anti-METTL21A Antibody

Product Images

WB Suggested Anti-METTL21A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-METTL21A antibody: synthetic peptide directed towards the N terminal of human METTL21A. Synthetic peptide located within the following region: ALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: methyltransferase like 21A
• Database Link:
  NP_660323
  Entrez Gene 151194 Human
  UniProt ID Q8WXB1
• Background: METTL21A is a multi-pass membrane protein. It belongs to the FAM119 family. The function of the METTL21A protein remains unknown.
• Synonyms: FAM119A; HCA557b; HSPA-KMT
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Bovine: 93%; Horse: 86%