C7ORF29 (ZBED6CL) Rabbit Polyclonal Antibody

CAT#: TA340289

Rabbit Polyclonal Anti-ZBED6CL Antibody

Product Images

WB Suggested Anti-ZBED6CL Antibody Titration: 0.2-1 ug/ml; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBED6CL antibody: synthetic peptide directed towards the middle region of human ZBED6CL. Synthetic peptide located within the following region: VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: ZBED6 C-terminal like
• Database Link:
  NP_612443
  Entrez Gene 113763 Human
  UniProt ID Q96FA7
• Background: The function of this protein remains unknown.
• Synonyms: C7orf29
• Note: Immunogen Sequence Homology: Human: 100%