C7ORF29 (ZBED6CL) Rabbit Polyclonal Antibody

CAT#: TA340289

Reviews ()
Write a review

Rabbit Polyclonal Anti-ZBED6CL Antibody



USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZBED6CL antibody: synthetic peptide directed towards the middle region of human ZBED6CL. Synthetic peptide located within the following region: VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name ZBED6 C-terminal like
Background The function of this protein remains unknown.
Synonyms C7orf29
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Other products for "ZBED6CL"
Frequently bought together (2)
Transient overexpression lysate of chromosome 7 open reading frame 29 (C7orf29)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies