PNK (PNKP) Rabbit Polyclonal Antibody

CAT#: TA340167

Rabbit Polyclonal Anti-PNKP Antibody

Product Images

WB Suggested Anti-PNKP Antibody; Titration: 1.0 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PNKP antibody: synthetic peptide directed towards the N terminal of human PNKP. Synthetic peptide located within the following region: MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: polynucleotide kinase 3'-phosphatase
• Database Link:
  NP_009185
  Entrez Gene 11284 Human
  UniProt ID Q96T60
• Background: This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.
• Synonyms: AOA4; EIEE10; MCSZ; PNK
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Phosphatase