OriGene Logo

p40 (RABEPK) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA340082
Rabbit Polyclonal Anti-RABEPK Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY417020 Transient overexpression lysate of Rab9 effector protein with kelch motifs (RABEPK) 100 ug
$436.00
TP308763 Recombinant protein of human Rab9 effector protein with kelch motifs (RABEPK), 20 µg
20 ug
$737.00

View other "p40 or NM_005833" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RABEPK antibody: synthetic peptide directed towards the N terminal of human RABEPK. Synthetic peptide located within the following region: SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 40
Gene Name Rab9 effector protein with kelch motifs
Database Link
Background RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.
Synonyms bA65N13.1; p40; RAB9P40
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 92%; Dog: 86%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.