C2orf60 (TYW5) Rabbit Polyclonal Antibody

SKU TA339897

Rabbit Polyclonal Anti-TYW5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C2orf60 antibody: synthetic peptide directed towards the middle region of human C2orf60. HLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: tRNA-yW synthesizing protein 5
• Database Link:
  NP_001034782
  A2RUC4
• Background: The function of the C2orf60 protein remains unknown.
• Synonyms: C2orf60; hTYW5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Rat: 86%; Mouse: 86%; Zebrafish: 79%

Reference Data