METTL14 Rabbit Polyclonal Antibody

CAT#: TA339744

Reviews ()
Write a review

Rabbit Polyclonal Anti-METTL14 Antibody



USD 539.00

5 Days*

Size
    • 100 ul

Product images

Frequently bought together (3)
Recombinant protein of human methyltransferase like 14 (METTL14)
    • 100 ug

USD 2,950.00


Transient overexpression lysate of methyltransferase like 14 (METTL14)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "METTL14"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KIAA1627 antibody: synthetic peptide directed towards the N terminal of human KIAA1627. Synthetic peptide located within the following region: LNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDEL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 52 kDa
Gene Name methyltransferase like 14
Background KIAA1627 is a probable methyltransferase.
Synonyms KIAA1627
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%
Reference Data
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.