Ovary specific acidic protein (MGARP) Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "Ovary specific acidic protein"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MGARP antibody is: synthetic peptide directed towards the C-terminal region of Human MGARP. Synthetic peptide located within the following region: EAVTIDNDKDTTKNETSDEYAELEEENSPAESESSAGDDLQEEASVGSEA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 26 kDa |
Gene Name | mitochondria localized glutamic acid rich protein |
Database Link | |
Background | MGARP plays a role in the trafficking of mitochondria along microtubules. It regulates the kinesin-mediated axonal transport of mitochondria to nerve terminals along microtubules during hypoxia. It participates in the translocation of TRAK2/GRIF1 from the cytoplasm to the mitochondrion. It also plays a role in steroidogenesis through maintenance of mitochondrial abundance and morphology. |
Synonyms | C4orf49; CESP-1; HUMMR; OSAP |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.