OriGene Logo

Ndufa10l1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339185
Rabbit Polyclonal Anti-Ndufa10l1
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "Ndufa10l1 or NM_182671" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Ndufa10l1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Ndufa10l1. Synthetic peptide located within the following region: KREVLNYTTVPVYLPEITIGAHQGSRIYDSFRELPGRKYAPGYNADVGDK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 39 kDa
Gene Name NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 10-like 1
Database Link
Background The function of this protein remains unknown.
Synonyms Ndufa10
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 86%; Bovine: 83%; Rat: 79%; Horse: 79%; Guinea pig: 79%
Reference Data
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.