Kmt5b Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "Kmt5b"
Specifications
Product Data | |
Applications | 10k-ChIP, WB |
Recommended Dilution | WB, ChIP |
Reactivities | Mouse, Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | . Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 35 kDa |
Gene Name | suppressor of variegation 4-20 homolog 1 (Drosophila) |
Database Link | |
Background | Suv420h1 is a histone methyltransferase that specifically trimethylates 'Lys-20' of histone H4. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. It mainly functions in pericentric heterochromatin region |
Synonyms | C630029K18Rik; CGI-85; CGI85; KMT5B; MGC703; MGC21161; MGC118906; MGC118909; OTTHUMP00000197482; OTTHUMP00000197488; Suv4-20h1 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Pig: 86%; Guinea pig: 86%; Rabbit: 77%; Zebrafish: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.