BRAF35 (HMG20B) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-HMG20B antibody: synthetic peptide directed towards the middle region of human HMG20B. Synthetic peptide located within the following region: AELRRLRKMNVAFEEQNAVLQRHTQSMSSARERLEQELALEERRTLALQQ |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 37 kDa |
| Gene Name | high mobility group 20B |
| Database Link | |
| Background | Required for correct progression through G2 phase of the cell cycle and entry into mitosis. Required for RCOR1/CoREST mediated repression of neuronal specific gene promoters. |
| Synonyms | BRAF25; BRAF35; HMGX2; HMGXB2; PP7706; pp8857; SMARCE1r; SOXL |
| Note | Immunogen Sequence Homology: Pig: 90%; Rat: 90%; Human: 90%; Mouse: 90%; Bovine: 90%; Guinea pig: 90% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Transciption Factors |
| Protein Families | Druggable Genome, Transcription Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.