ZNF230 Rabbit Polyclonal Antibody

CAT#: TA339125

Reviews ()
Write a review

Rabbit Polyclonal Anti-ZNF230 Antibody



USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF230 antibody: synthetic peptide directed towards the N terminal of human ZNF230. Synthetic peptide located within the following region: IHTGQKPSQNGKCKQSFSDVAIFDPPQQFHSGEKSHTCNECGKSFCYISA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 54 kDa
Gene Name zinc finger protein 230
Background May be involved in transcriptional regulation.
Synonyms FDZF2
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transcription Factors
Other products for "ZNF230"
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 230 (ZNF230)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies