Carbohydrate sulfotransferase 4 (CHST4) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4 (CHST4), transcript variant 1
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "Carbohydrate sulfotransferase 4"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CHST4 antibody: synthetic peptide directed towards the middle region of human CHST4. Synthetic peptide located within the following region: QKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 45 kDa |
Gene Name | carbohydrate sulfotransferase 4 |
Database Link | |
Background | This gene encodes an N-acetylglucosamine 6-O sulfotransferase. The encoded enzyme transfers sulfate from 3'phosphoadenosine 5'phospho-sulfate to the 6-hydroxyl group of N-acetylglucosamine on glycoproteins. This protein is localized to the Golgi and is involved in the modification of glycan structures on ligands of the lymphocyte homing receptor L-selectin. Alternate splicing in the 5' UTR results in multiple transcript variants that encode the same protein. [provided by RefSeq, Oct 2009] |
Synonyms | GlcNAc6ST2; GST3; HECGLCNAC6ST; LSST |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 86%; Horse: 79%; Bovine: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Keratan sulfate biosynthesis, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.